PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678467723
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 296aa    MW: 31261.7 Da    PI: 8.4965
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678467723genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702202.99.1e-63972465154
     DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkeletss 104
                 asCqdCGnqak+dC+h+RCRtCCksrgfdC+thvkstWvpaa+rr+r ++ ++++s +++++   as+ ++++++++++ + s  + s ++   l  ss
  678467723  97 MASCQDCGNQAKRDCSHQRCRTCCKSRGFDCTTHVKSTWVPAARRRDRAAASSQSTSGSKKQKLGGASETTNTTSASNTTPTRSFDTISIQQGGGLGESS 196
                579*********************************************99999999988888877778888887778888888888889999999***** PP

     DUF702 105 lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                +P +v+++avf+cvrv+++dd+ +++aYq++v igGhvf+G+Lyd+G+e+
  678467723 197 FPGQVRAPAVFKCVRVTALDDDADQYAYQAVVRIGGHVFRGFLYDHGVEA 246
                ***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.3E-5898245IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.0E-2699141IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.3E-27197244IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MWSSGVGGSR HGVPPEFFFV APEGVSTFDP NVAIGVIPLL TAAPCHAPTL QASEEGMSAR  60
RSSIGFGMHL WQQQQQGQRL SSSSSTKPII PEASNAMASC QDCGNQAKRD CSHQRCRTCC  120
KSRGFDCTTH VKSTWVPAAR RRDRAAASSQ STSGSKKQKL GGASETTNTT SASNTTPTRS  180
FDTISIQQGG GLGESSFPGQ VRAPAVFKCV RVTALDDDAD QYAYQAVVRI GGHVFRGFLY  240
DHGVEAREGL PNLPDLHLSG GNTNNAASSS HRAPLPADIY AGGGGMEVTK YGNPLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838439.18e-91PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK92e-65LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A022R8A62e-90A0A022R8A6_ERYGU; Uncharacterized protein
STRINGBra008898.1-P3e-73(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76552331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.24e-41Lateral root primordium (LRP) protein-related